powered by:
Protein Alignment DnaJ-1 and dnajc25
DIOPT Version :9
Sequence 1: | NP_523936.2 |
Gene: | DnaJ-1 / 38643 |
FlyBaseID: | FBgn0263106 |
Length: | 334 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011497.1 |
Gene: | dnajc25 / 496999 |
XenbaseID: | XB-GENE-954361 |
Length: | 368 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 42/71 - (59%) |
Gaps: | 11/71 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 YKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQ-----------AEERFKEIAEAYEVLSDKK 59
|.:||:.|.||..:|.:|||:||.|||||:.:..: |:|:|..:|.|||.|.|::
Frog 59 YDVLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATAYETLKDEE 123
Fly 60 KRDIFD 65
.|..:|
Frog 124 TRKDYD 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.