DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajb1

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001008112.1 Gene:dnajb1 / 493474 XenbaseID:XB-GENE-1003017 Length:350 Species:Xenopus tropicalis


Alignment Length:356 Identity:191/356 - (53%)
Similarity:236/356 - (66%) Gaps:30/356 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            ||||:|||||:.:.|:::||||||||.||||||||||.|.||:|||||||||:||||.|||::||
 Frog     1 MGKDYYKILGIPKGATEEEIKKAYRKQALKYHPDKNKDPGAEDRFKEIAEAYDVLSDPKKREVFD 65

  Fly    66 NYGEDGLKGGQPGPDG--GGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFS------ 122
            .|||:||| |.||..|  ||..|.|:|.|||||.|.||:|||..:||..||...|:...      
 Frog    66 KYGEEGLK-GTPGGGGSSGGPNGTYSYTFHGDPHAVFAEFFGGRNPFDGFFGRNDDDMDTDDPFA 129

  Fly   123 --GGQGGNTNEIFWNIGG-------DDMFAFNAQAPSRK----RQQDPPIEHDLFVSLEEVDKGC 174
              ||.||     |..:||       ..|..|...|..|:    |:|||||..:|.||||||..||
 Frog   130 GFGGMGG-----FGGMGGMGGMGGMGGMGGFPRSASGRRDTVPRKQDPPITRELPVSLEEVFNGC 189

  Fly   175 IKKMKISRMATGSNG--PYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPH 237
            .||||||....|.:|  ...|:|:|.|.||.|||.|||||||:|||..|:..||||||:::||.|
 Frog   190 TKKMKISHKRLGPDGRSVRNEDKILTIQVKKGWKEGTKITFPKEGDETPSNIPADIVFVLKDKSH 254

  Fly   238 SLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEP 302
            .:|||||.|:.||::|||::||||..|::||:....|.:... :||:|.|.|||...|||:||.|
 Frog   255 PVFKREGSDVVYTSKISLREALCGCSVNIPTVDNRTIPLTFT-DIIRPGTKRRITNEGLPLPKSP 318

  Fly   303 SRRGDLIVSFDIKFPDTLAPSLQNQLSELLP 333
            .:||||||.|||:||:.|..|.:..|..:||
 Frog   319 DQRGDLIVEFDIRFPERLTASSREVLERVLP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 189/354 (53%)
DnaJ 4..65 CDD:278647 44/60 (73%)
DnaJ_C 157..320 CDD:199909 92/164 (56%)
dnajb1NP_001008112.1 DnaJ 1..345 CDD:223560 188/350 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3393
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 368 1.000 Inparanoid score I2100
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm14098
Panther 1 1.100 - - O PTHR24078
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.