DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and CG11035

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:97 Identity:32/97 - (32%)
Similarity:54/97 - (55%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLERKASDDEIKKAYRKLALKYHPDKNK-SPQAEERFKEIAEAYEVLSDKKKRDIFD---- 65
            |..||:.|:.:.:|||.||.||::.||||:|: |..|.::|:||.:|||:|.:.:.|.::|    
  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV 93

  Fly    66 -----NYGEDGLKGGQPGPDGGGQPGAYTYQF 92
                 .|.:|.....:|..:...:...|..:|
  Fly    94 HTAGAQYAQDVHDVAEPVVEDDAETKFYKSRF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 32/97 (33%)
DnaJ 4..65 CDD:278647 26/59 (44%)
DnaJ_C 157..320 CDD:199909
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/59 (44%)
DnaJ 27..89 CDD:278647 26/59 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.