DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnaja3b

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_958499.1 Gene:dnaja3b / 394242 ZFINID:ZDB-GENE-040115-3 Length:474 Species:Danio rerio


Alignment Length:379 Identity:103/379 - (27%)
Similarity:152/379 - (40%) Gaps:112/379 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            :|||::||:.|.||..||||||.:||.|||||.| ..|.|:|:|.::|||||.|||:.||..:|.
Zfish    85 QDFYEVLGVPRTASQKEIKKAYYQLAKKYHPDTNPDDPDAKEKFAKLAEAYETLSDELKRKQYDT 149

  Fly    67 YGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQG----- 126
            ||..|     |...|.||...:....:.||...|.:.||.              |:||:|     
Zfish   150 YGSAG-----PSASGTGQQQYWRGSANVDPEELFRKIFGE--------------FAGGRGFGDIN 195

  Fly   127 --------------------GNTNEIFWNIGGD----DMFAFNAQAPSRKRQQDPPIEHDLF--- 164
                                |...||..||..|    |..||.   |..|      :.|..:   
Zfish   196 SMFDQAPEFVMELSFMQAAKGVNKEITVNIDDDCPRCDGKAFE---PGTK------VSHCHYCNG 251

  Fly   165 VSLEEVDKGCIKKMKISRMATG-------------SNGPYKEEKVLRITVKPGWKAGTKITFPQE 216
            ..:|.::.|........|..:|             .:|..|:::.:.:.|..|...|..:..|  
Zfish   252 TGMESINTGPFMMRSACRRCSGRGFIIITPCIMCRGSGQTKQKQTVMVPVPAGIADGQTVKVP-- 314

  Fly   217 GDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGS-RIQVNP-- 278
                ..|....|.|.::..|  :|:|:|.|:.....||:.||:.|.......|..: .|.:.|  
Zfish   315 ----VGKKHMYITFRVQKSP--VFRRDGADIHSDVLISIAQAILGGTARAQGLYSTIDIAIPPGI 373

  Fly   279 --NHEIIKPTTTRRINGLGLP-----------------VPKEPSRRGD-LIVSF 312
              :|:|       ::.|.|:|                 :||:.:||.. |::||
Zfish   374 QTDHKI-------KLEGKGIPRMNSFGYGDHYVYIKIKIPKKLTRRQKMLLLSF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 103/379 (27%)
DnaJ 4..65 CDD:278647 36/61 (59%)
DnaJ_C 157..320 CDD:199909 39/195 (20%)
dnaja3bNP_958499.1 DnaJ 85..428 CDD:223560 103/379 (27%)
DnaJ 86..148 CDD:278647 36/61 (59%)
DnaJ_C 203..409 CDD:199909 45/229 (20%)
DnaJ_zf 229..289 CDD:199908 10/68 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.