powered by:
Protein Alignment DnaJ-1 and dnajc5gb
DIOPT Version :9
Sequence 1: | NP_523936.2 |
Gene: | DnaJ-1 / 38643 |
FlyBaseID: | FBgn0263106 |
Length: | 334 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005158621.1 |
Gene: | dnajc5gb / 393371 |
ZFINID: | ZDB-GENE-040426-1238 |
Length: | 212 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 41/72 - (56%) |
Similarity: | 55/72 - (76%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GKDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
|:..|:.|||::.||.::|||||||||||:||||| .:|:|.|:||||..|..:|:|:.||.|:|
Zfish 15 GESLYQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNNPEAAEKFKEINNANSILNDETKRQIYD 79
Fly 66 NYGEDGL 72
.||..||
Zfish 80 EYGSMGL 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.