DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajb6b

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009301640.1 Gene:dnajb6b / 393275 ZFINID:ZDB-GENE-040426-1122 Length:311 Species:Danio rerio


Alignment Length:131 Identity:66/131 - (50%)
Similarity:87/131 - (66%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS--PQAEERFKEIAEAYEVLSDKKKRDI 63
            |.:|:|.|||:.:.||.|:|||||||||||:|||||.:  .:||:|||||:||||||||:.||..
Zfish     1 MEEDYYHILGVTKSASPDDIKKAYRKLALKWHPDKNPNDKEEAEKRFKEISEAYEVLSDENKRRD 65

  Fly    64 FDNYGEDGL--KGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQG 126
            :|.||:.||  :||....:   ..|.:|::   :|...|.:|||..|||..||  .|:.|.|..|
Zfish    66 YDRYGKQGLSNRGGHYDDE---YMGGFTFR---NPEDVFREFFGGHDPFADFF--ADDTFEGFFG 122

  Fly   127 G 127
            |
Zfish   123 G 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 66/131 (50%)
DnaJ 4..65 CDD:278647 41/62 (66%)
DnaJ_C 157..320 CDD:199909
dnajb6bXP_009301640.1 DnaJ 4..67 CDD:278647 41/62 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.