DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB13

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:325 Identity:136/325 - (41%)
Similarity:197/325 - (60%) Gaps:25/325 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGEDGLKGG 75
            ||...::|:.:: ||:||||:||.|:..|.:.|.|::|||||:||||..||.|:|.:||:|||||
Human    46 LEHSTAEDKDQR-YRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGG 109

  Fly    76 QPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFWNIGGDD 140
            .|...|...|....|.|||.|...|.:|||.::||..||        ..:|   :|:..|.||  
Human   110 IPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFF--------DAEG---SEVDLNFGG-- 161

  Fly   141 MFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSNGPYK---EEKVLRITVK 202
                 .|....|: |||.:|.||::|||::..||.||:||||.....:| |.   ::|:|.|.||
Human   162 -----LQGRGVKK-QDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDG-YSSTIKDKILTIDVK 219

  Fly   203 PGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVP 267
            |||:.||:|||.:|||..||..||||:||:::|.|..|:||..:|.:...|.|.:||....|.|.
Human   220 PGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVR 284

  Fly   268 TLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELL 332
            ||....:.: |.::||.|...:::.|.|:|:|::|:::|||.:.|||:||..|.|..:..|.:.|
Human   285 TLDDRLLNI-PINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 348

  Fly   333  332
            Human   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 136/325 (42%)
DnaJ 4..65 CDD:278647 27/53 (51%)
DnaJ_C 157..320 CDD:199909 72/165 (44%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 133/319 (42%)
DnaJ 48..99 CDD:278647 25/51 (49%)
DnaJ_C 174..336 CDD:199909 71/163 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.