powered by:
Protein Alignment DnaJ-1 and Dnajc25
DIOPT Version :9
Sequence 1: | NP_523936.2 |
Gene: | DnaJ-1 / 38643 |
FlyBaseID: | FBgn0263106 |
Length: | 334 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020192.1 |
Gene: | Dnajc25 / 362526 |
RGDID: | 1561488 |
Length: | 357 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 29/72 - (40%) |
Similarity: | 44/72 - (61%) |
Gaps: | 9/72 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNK---------SPQAEERFKEIAEAYEVLSDK 58
:|.|::||:.|.||..||.:|||:||.:||||:.: :|.:.|.|..:|.|||.|.|:
Rat 47 RDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDE 111
Fly 59 KKRDIFD 65
:.|..:|
Rat 112 ETRKDYD 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.