DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb6

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_006235925.1 Gene:Dnajb6 / 362293 RGDID:1308207 Length:364 Species:Rattus norvegicus


Alignment Length:308 Identity:96/308 - (31%)
Similarity:131/308 - (42%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            |:|::||::|.||.::|||||||.|||:|||||  ...:||.:||::|||||||||.|||||:|.
  Rat     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly    67 YGEDGLKGGQPGPDGGG---QPGAYTYQFHGDPRATFAQFFGSSDPF------------------ 110
            ||::||.||  |..||.   .|..:.:.|. :|...|.:|||..|||                  
  Rat    68 YGKEGLNGG--GGGGGSHFDSPFEFGFTFR-NPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRG 129

  Fly   111 ---------GAFFTGGDNMFSG---------------------GQGGNTNEIFWNIGGDDMFAFN 145
                     |:||:.    |||                     |.||.|:....:.||..|..|.
  Rat   130 PRGSRSRGAGSFFSA----FSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSASFGGSGMGNFK 190

  Fly   146 AQAPSRKRQQDPPIEHDLFVS-----LEEVDKGCIKKMKISRMATG-----------------SN 188
            :.:.|.|......|.....|.     :|..:.|.:|.:.|:.:|..                 :.
  Rat   191 SISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGVADENALAEECRRRGQPTPALAP 255

  Fly   189 GPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKP 236
            ||......:....:|...|.|         .||.:|||..|.....||
  Rat   256 GPAPAPARVPSQARPPTPAPT---------PAPAQTPAPSVSTRPQKP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 96/308 (31%)
DnaJ 4..65 CDD:278647 40/62 (65%)
DnaJ_C 157..320 CDD:199909 20/102 (20%)
Dnajb6XP_006235925.1 DnaJ 2..>107 CDD:223560 56/106 (53%)
DnaJ 3..66 CDD:278647 40/62 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.