DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajc24

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:85 Identity:30/85 - (35%)
Similarity:47/85 - (55%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS-------PQAEERFKEIAEAYEVLSD--- 57
            ||:|.|||.:..|...::|:.|:||.|.|||||..:       .:..::|.||.:|:::|.:   
  Rat     9 KDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEET 73

  Fly    58 KKKRDIFDNYGEDGLKGGQP 77
            |||.|:  ...||.|:...|
  Rat    74 KKKYDL--QRHEDELRNVGP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 30/85 (35%)
DnaJ 4..65 CDD:278647 25/70 (36%)
DnaJ_C 157..320 CDD:199909
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 24/67 (36%)
zf-CSL 94..147 CDD:398744
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.