DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and K07F5.16

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001023271.1 Gene:K07F5.16 / 3565979 WormBaseID:WBGene00010640 Length:155 Species:Caenorhabditis elegans


Alignment Length:107 Identity:27/107 - (25%)
Similarity:43/107 - (40%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLERKASDDEIKKAYRKLALKYHPDKNK--SPQAEERFKEIAEAYEVLSDKKKRDIFDNYG 68
            |::||.:..:|.|:|...||......||||.|  :..:.|:|.|:..||.:|:...:|..:|:: 
 Worm    17 YRLLGCDESSSIDQITAEYRARVRDCHPDKVKEHNTNSTEKFMELQNAYSILTSDSRRKTYDSW- 80

  Fly    69 EDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPF 110
                                   .|.....:|..|..|.|.|
 Worm    81 -----------------------LHSPFPVSFEDFTKSQDTF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 27/107 (25%)
K07F5.16NP_001023271.1 DnaJ 16..78 CDD:395170 20/60 (33%)
DnaJ 17..153 CDD:440252 27/107 (25%)

Return to query results.
Submit another query.