DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and shv

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:358 Identity:110/358 - (30%)
Similarity:161/358 - (44%) Gaps:96/358 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNK-SPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            |:||||||.:::.|:.:|:|||||:||.:.|||||| .|.|..:|:::..||||||:..||..:|
  Fly    23 GRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDASTKFQDLGAAYEVLSNPDKRKTYD 87

  Fly    66 NYGEDGLKGGQPG-PDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNT 129
            ..||:.||  :.| .|.||.|              |:.|||.   || |..|||     ||    
  Fly    88 RCGEECLK--KEGMMDHGGDP--------------FSSFFGD---FG-FHFGGD-----GQ---- 123

  Fly   130 NEIFWNIGGDDMFAFNAQAPSRKRQQDPP----IEHDLFVSLEEVDKG----CIKKMKISRMATG 186
                                    |||.|    |..||:|||||:..|    .::...:::.|:|
  Fly   124 ------------------------QQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTKPASG 164

  Fly   187 SN-------------GP-------------------YKEEKVLRITVKPGWKAGTKITFPQEGDS 219
            :.             ||                   ..||:.|.|.|:.|...|.:..|..||:.
  Fly   165 TRKCNCRQEMVTRNLGPGRFQMIQQTVCDECPNVKLVNEERTLEIEVEQGMVDGQETRFVAEGEP 229

  Fly   220 APNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIK 284
            ..:..|.|::..::..||..|.|:..||.....|||:.||.|..:.:..|.|..:.|. ..::..
  Fly   230 HIDGEPGDLIVRVQQMPHPRFLRKNDDLYTNVTISLQDALVGFSMEIKHLDGHLVPVT-REKVTW 293

  Fly   285 PTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFP 317
            |....|..|.|:|..:..:..|:|.::||::||
  Fly   294 PGARIRKKGEGMPNFENNNLTGNLYITFDVEFP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 110/358 (31%)
DnaJ 4..65 CDD:278647 32/61 (52%)
DnaJ_C 157..320 CDD:199909 52/201 (26%)
shvNP_608525.1 DnaJ 22..346 CDD:223560 110/358 (31%)
DnaJ 25..87 CDD:278647 32/61 (52%)
DnaJ_C 131..328 CDD:199909 51/197 (26%)
DnaJ_zf 160..>195 CDD:304418 4/34 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.