DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB2

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens


Alignment Length:365 Identity:104/365 - (28%)
Similarity:149/365 - (40%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQ--AEERFKEIAEAYEVLSDKKKRDIFDNY 67
            :|:||.:.|.||.|:||||||:.||::|||||...:  ||::|||:||||||||||.||:|:|.|
Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly    68 GEDGLKGGQPGPD----GGGQPGAYTYQFHGDPRATFAQFFGSSDPF------------------ 110
            |.:||.|...||.    |.|.|| :|:.|. .|...|.:||||.|||                  
Human    69 GREGLTGTGTGPSRAEAGSGGPG-FTFTFR-SPEEVFREFFGSGDPFAELFDDLGPFSELQNRGS 131

  Fly   111 ---GAFFTGGDNM------------FSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRK----RQQD 156
               |.|||...:.            ||.|.|.     |.::.....|....:..:|:    .|:.
Human   132 RHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGA-----FRSVSTSTTFVQGRRITTRRIMENGQER 191

  Fly   157 PPIEHDLFVSLEEVDKGCIKKMKIS----RMATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEG 217
            ..:|.|          |.:|.:.|:    .:|.|.....:|::. .:|.:.|   ||::      
Human   192 VEVEED----------GQLKSVTINGVPDDLALGLELSRREQQP-SVTSRSG---GTQV------ 236

  Fly   218 DSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQAL----CGALVSVPTLQGSRIQVNP 278
            ...|...|.|         ..|.:.|.:.|.....:|..:|.    .|...:....||       
Human   237 QQTPASCPLD---------SDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQG------- 285

  Fly   279 NHEIIKPTTTRRINGLG-------------LPVPKEPSRR 305
                 :|....:..|||             .|.|:|.:.|
Human   286 -----RPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 104/365 (28%)
DnaJ 4..65 CDD:278647 38/61 (62%)
DnaJ_C 157..320 CDD:199909 31/170 (18%)
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 57/107 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324 24/134 (18%)
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324 104/365 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.