DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnaja2b

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_997830.1 Gene:dnaja2b / 324164 ZFINID:ZDB-GENE-030131-2884 Length:413 Species:Danio rerio


Alignment Length:395 Identity:125/395 - (31%)
Similarity:185/395 - (46%) Gaps:111/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGED 70
            |.:||:...||::|:||||||||.:||||||  |.|.::||||:.|||||::.:|:|::|.|||.
Zfish    10 YDLLGVSPSASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLTNPEKKDLYDRYGEQ 72

  Fly    71 GLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFWN 135
            ||:.|     |||  ||                 |..|.|...|.||...|.|||...:..    
Zfish    73 GLREG-----GGG--GA-----------------GMEDIFSHIFGGGLFGFMGGQSSKSRN---- 109

  Fly   136 IGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISR------------------ 182
             ||            |:|.:|  :.|.|.||||::..|...|:::|:                  
Zfish   110 -GG------------RRRGED--MIHPLKVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKTGAVQ 159

  Fly   183 ---------------------------MATGSNGP------------------YKEEKVLRITVK 202
                                       :.|..||.                  .||.|||.:.|.
Zfish   160 KCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGEVIHEKDRCKECDGRKVCKEVKVLEVHVD 224

  Fly   203 PGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVP 267
            .|.|.|.||||..|.|.:||..|.||:.::::|.|..|:|:|.||....:|.|.:||||....:.
Zfish   225 KGMKHGQKITFSGEADQSPNTEPGDIILVLQEKDHEEFRRDGNDLHIGHKIGLVEALCGFQFMLT 289

  Fly   268 TLQGSRIQVN-PNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDT--LAPSLQNQLS 329
            .|.|..:.:. |..::::|.:.|.:.|.|:|..:.|..:|||.:.||::||:.  ::....::|.
Zfish   290 HLDGRHLVIKYPPGKVVEPGSIRVVRGEGMPQYRNPFEKGDLFIKFDVQFPENGWISTEKLSELE 354

  Fly   330 ELLPN 334
            :|||:
Zfish   355 DLLPS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 123/392 (31%)
DnaJ 4..65 CDD:278647 33/58 (57%)
DnaJ_C 157..320 CDD:199909 61/228 (27%)
dnaja2bNP_997830.1 PTZ00037 4..413 CDD:240236 125/395 (32%)
DnaJ 9..67 CDD:278647 33/58 (57%)
DnaJ_C 116..342 CDD:199909 62/227 (27%)
DnaJ_zf 145..211 CDD:199908 3/65 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.