DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnaja1

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:401 Identity:118/401 - (29%)
Similarity:171/401 - (42%) Gaps:131/401 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69
            ||.:||::..||.:|:||||||||||||||||  |...|:||:|::|||||||.|||:::|..||
Zfish     7 FYDMLGVKPSASPEELKKAYRKLALKYHPDKN--PTEGEKFKQISQAYEVLSDAKKREVYDRGGE 69

  Fly    70 DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDP---FGAFFTGGDNMFSGGQGGNTNE 131
            ..:|.|     |.|                     ||..|   |..||.||..|....:|.|   
Zfish    70 KAIKEG-----GNG---------------------GSCSPMDIFDLFFGGGGRMHRERRGKN--- 105

  Fly   132 IFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKM------------------ 178
                                       :.|.|.||||::..|..:|:                  
Zfish   106 ---------------------------VVHQLTVSLEDLYNGTTRKLALQKNVICDKCEGRGGRK 143

  Fly   179 ---------------------------KISRMATGSNGP------------------YKEEKVLR 198
                                       :||.:..|..|.                  .:::|:|.
Zfish   144 GVIEVCPLCRGVGVQVRLHHLAPGMVQQISTVCEGCQGQGQRLGHRDRCKTCTGRKILRQKKILE 208

  Fly   199 ITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGAL 263
            :.:..|.|.|.||.|..|||..|...|.||:.::..:.|.|:.|:|.||..:.::.|.::|||..
Zfish   209 VHIDKGMKDGQKIVFHGEGDQEPGLKPGDIIIVLDQRAHPLYTRQGDDLIVSMELQLVESLCGFQ 273

  Fly   264 VSVPTLQGSRIQVNPNH--EIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQN 326
            ..:.||. ||..:..:|  |:|||...:.:...|:|:.:.|..:|.||:..::.||:.....| |
Zfish   274 KPIKTLD-SRTLLITSHPGELIKPGDKKCVMNEGMPMHRRPFEKGKLIIHSNVVFPEENFLPL-N 336

  Fly   327 QLSEL---LPN 334
            :|.||   |||
Zfish   337 KLKELERFLPN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 115/398 (29%)
DnaJ 4..65 CDD:278647 38/59 (64%)
DnaJ_C 157..320 CDD:199909 54/227 (24%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 118/401 (29%)
DnaJ 7..65 CDD:278647 38/59 (64%)
DnaJ_C 104..330 CDD:199909 55/256 (21%)
DnaJ_zf 133..199 CDD:199908 4/65 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.