DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb13

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001005885.1 Gene:Dnajb13 / 308857 RGDID:1359131 Length:316 Species:Rattus norvegicus


Alignment Length:338 Identity:147/338 - (43%)
Similarity:204/338 - (60%) Gaps:30/338 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            ||.|:|.:|.:.|.:.|.:|||||||||||.||.|:..|.|.|.|::|||||:||||..||.|:|
  Rat     1 MGMDYYAVLQVNRNSEDAQIKKAYRKLALKNHPLKSNEPTAPEIFRQIAEAYDVLSDPVKRGIYD 65

  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
            .:||:|||||.|...|...|....|.|||:|...|.:|||..:||..||        ..:|   |
  Rat    66 KFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPEKVFHEFFGGDNPFSEFF--------DAEG---N 119

  Fly   131 EIFWNIGGDDMFAFNAQAPSRKR---QQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSNGPYK 192
            :|..|.||           .|.|   :||||||.||::|||::..||.||:||||.....:| |.
  Rat   120 DIDLNFGG-----------LRGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDG-YS 172

  Fly   193 ---EEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQIS 254
               ::|:|.|.|:|||:.||:|||.:|||..||..||||:||:::|.|..|:||..:|.:...|.
  Rat   173 STIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREQDNLFFVYPIP 237

  Fly   255 LKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDT 319
            |.:||....|.|.||....:.: |.::|:.|...:.:.|.|:|:|::|:::|||.:.|||:||..
  Rat   238 LGKALTCCTVEVKTLDDRLLNI-PINDIVHPKYFKMVPGEGMPLPEDPTKKGDLFIFFDIQFPTR 301

  Fly   320 LAPSLQNQLSELL 332
            |.|..:..|.:.|
  Rat   302 LTPQKKQMLRQAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 147/338 (43%)
DnaJ 4..65 CDD:278647 35/60 (58%)
DnaJ_C 157..320 CDD:199909 72/165 (44%)
Dnajb13NP_001005885.1 DnaJ 1..312 CDD:223560 146/334 (44%)
DnaJ 4..65 CDD:278647 35/60 (58%)
DnaJ_C 138..302 CDD:199909 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X227
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.