DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb4

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:346 Identity:190/346 - (54%)
Similarity:243/346 - (70%) Gaps:24/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            ||||:|.|||:|:.|:|::|||||||.|||:||||||||||||:|||:|||||||||.|||:|:|
  Rat     1 MGKDYYHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
            .:||:|||||..|.||.|  |.:.|.|||||.||||.|||.::||..||  |..|   |.|.::.
  Rat    66 QFGEEGLKGGAGGTDGQG--GTFRYTFHGDPHATFAAFFGGANPFEIFF--GRRM---GGGRDSE 123

  Fly   131 EIFWNIGGDDMFAF-----------NAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMA 184
            |:  .|.||...||           |:..|||.: |||||.|:|.|||||:..||.|:|||||..
  Rat   124 EM--EIDGDPFSAFGFSMNGYPRDRNSVGPSRLK-QDPPIIHELKVSLEEIYSGCTKRMKISRKR 185

  Fly   185 TGSNG-PYK-EEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDL 247
            ...:| .|: |:|:|.|.:|.|||.|||||||:|||..||..||||||||:||.|..|||:|.::
  Rat   186 LNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKEHPKFKRDGSNI 250

  Fly   248 KYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSF 312
            .|||:|||::||||..::|||:.|..|.::.. :|:||...|||.|.|||.||.|.:||||::.|
  Rat   251 VYTAKISLREALCGCSINVPTMDGRNIPMSVT-DIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEF 314

  Fly   313 DIKFPDTLAPSLQNQLSELLP 333
            |:.|||.::.:.:..|.:.||
  Rat   315 DVSFPDVISAASKEILRKHLP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 188/344 (55%)
DnaJ 4..65 CDD:278647 46/60 (77%)
DnaJ_C 157..320 CDD:199909 92/164 (56%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 188/341 (55%)
DnaJ 4..65 CDD:278647 46/60 (77%)
DnaJ_C 158..320 CDD:199909 90/162 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3167
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100610
Inparanoid 1 1.050 371 1.000 Inparanoid score I2057
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm8916
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X227
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.