DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and erj5

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_594141.1 Gene:erj5 / 2541520 PomBaseID:SPAC2E1P5.03 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:86 Identity:31/86 - (36%)
Similarity:47/86 - (54%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69
            ||::|.:..|||..||.:||||.::.||||||  |:::|.:..:.....:|.:.:.|..:|.:  
pombe    41 FYELLEVPTKASIKEINRAYRKKSILYHPDKN--PKSKELYTLLGLIVNILRNTETRKRYDYF-- 101

  Fly    70 DGLKGGQPGPDGGGQPGAYTY 90
              ||.|.|...|.|    |.|
pombe   102 --LKNGFPRWKGTG----YLY 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 31/86 (36%)
erj5NP_594141.1 PRK14288 40..>179 CDD:172776 31/86 (36%)
DnaJ 40..99 CDD:395170 22/59 (37%)

Return to query results.
Submit another query.