DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb9

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:153 Identity:60/153 - (39%)
Similarity:82/153 - (53%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            |::|.|||:.:.||:.:||||:.|||:||||||||||.||.:|:|||||||.|||..:|..:|..
  Rat    37 KNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDII 101

  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFG------SSDPFGAFFTGGDNMFSGGQG 126
            |......|: |....|.|...::.|:.|........||      |...|       :|.|...|.
  Rat   102 GHSAFTNGK-GQRSNGSPFEQSFNFNFDDLFKDFNLFGQNQNTRSKKHF-------ENHFQTRQD 158

  Fly   127 GNTNEIF----WNIGG---DDMF 142
            |::.:..    ::.||   ||||
  Rat   159 GSSRQRHHFQEFSFGGGLFDDMF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 60/153 (39%)
DnaJ 4..65 CDD:278647 37/60 (62%)
DnaJ_C 157..320 CDD:199909
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 49/110 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.