DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-1 and CG30156

DIOPT Version :9

Sequence 1:	NP_523936.2	Gene:	DnaJ-1 / 38643	FlyBaseID:	FBgn0263106	Length:	334	Species:	Drosophila melanogaster
Sequence 2:	NP_001260752.1	Gene:	CG30156 / 246488	FlyBaseID:	FBgn0050156	Length:	358	Species:	Drosophila melanogaster

Alignment Length:	59	Identity:	29/59 - (49%)
Similarity:	44/59 - (74%)	Gaps:	0/59 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKR 61
            ::.|::|.:...|:..|:|:||.||||:.||||||||.||:.|:.|:||.:.|:|.:||
  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKR 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-1	NP_523936.2	DnaJ	1..333	CDD:223560	29/59 (49%)
		DnaJ	4..65	CDD:278647	29/58 (50%)
		DnaJ_C	157..320	CDD:199909
CG30156	NP_001260752.1	DnaJ	96..157	CDD:278647	29/58 (50%)
CG30156	NP_001260752.1	DUF1977	237..334	CDD:286411
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45458975
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.740