Sequence 1: | NP_523936.2 | Gene: | DnaJ-1 / 38643 | FlyBaseID: | FBgn0263106 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689899.1 | Gene: | DNAJC18 / 202052 | HGNCID: | 28429 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 69/198 - (34%) |
---|---|---|---|
Similarity: | 97/198 - (48%) | Gaps: | 33/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
Fly 68 GEDGLKGGQPGPDGGGQPGAYTYQFHGD--PRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
Fly 131 EIFWNIGGDDMFAF-------NAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSN 188
Fly 189 GPY 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DnaJ-1 | NP_523936.2 | DnaJ | 1..333 | CDD:223560 | 69/198 (35%) |
DnaJ | 4..65 | CDD:278647 | 35/60 (58%) | ||
DnaJ_C | 157..320 | CDD:199909 | 10/35 (29%) | ||
DNAJC18 | NP_689899.1 | DnaJ | 82..143 | CDD:278647 | 35/60 (58%) |
DUF1977 | 250..350 | CDD:286411 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |