DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnj-3

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_506711.1 Gene:dnj-3 / 182084 WormBaseID:WBGene00001021 Length:191 Species:Caenorhabditis elegans


Alignment Length:76 Identity:24/76 - (31%)
Similarity:45/76 - (59%) Gaps:13/76 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAE------------ERFKEIAEAYEV 54
            |::|:|:|:...|:..||:.|:.|...:.|||:: ||.:::            |:|..:.|||:|
 Worm    17 KNYYEIIGVSASATRQEIRDAFLKKTKQLHPDQSRKSSKSDSRVGWATGSSETEQFMLVKEAYDV 81

  Fly    55 LSDKKKRDIFD 65
            |.:::||..:|
 Worm    82 LRNEEKRKEYD 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 24/76 (32%)
DnaJ 4..65 CDD:278647 22/73 (30%)
DnaJ_C 157..320 CDD:199909
dnj-3NP_506711.1 DnaJ_bact 19..>92 CDD:274090 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.