DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnj-20

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001370249.1 Gene:dnj-20 / 174514 WormBaseID:WBGene00001038 Length:355 Species:Caenorhabditis elegans


Alignment Length:371 Identity:119/371 - (32%)
Similarity:178/371 - (47%) Gaps:90/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQ-AEERFKEIAEAYEVLSDKKKRDIFD 65
            |:|||||||:.:.|:.::|||||||||.:.|||:|:..: |.|:|::::.||||||||:||.::|
 Worm    22 GRDFYKILGVAKNANANQIKKAYRKLAKELHPDRNQDDEMANEKFQDLSSAYEVLSDKEKRAMYD 86

  Fly    66 NYGEDGL--KGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGN 128
            .:||:|:  .||     |||                     |..|||.:||  ||  |.||.||:
 Worm    87 RHGEEGVAKMGG-----GGG---------------------GGHDPFSSFF--GD--FFGGGGGH 121

  Fly   129 TNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKG-------------------- 173
            ..|.....|.|                   :..||||:||||..|                    
 Worm   122 GGEEGTPKGAD-------------------VTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQ 167

  Fly   174 --CIKKMKISRMATGSNGPY--------------KEEKVLRITVKPGWKAGTKITFPQEGDSAPN 222
              |..:|:..:|..|....:              :|.|||.:.|:.|...|.:..|..||:....
 Worm   168 CNCRHEMRTEQMGQGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIE 232

  Fly   223 KTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTT 287
            ..|.|:.|.||.:.|..|:|:|.||.....|||:.||.|..:.:..|.|..::|. ..::..|..
 Worm   233 GDPGDLKFKIRIQKHPRFERKGDDLYTNVTISLQDALNGFEMEIQHLDGHIVKVQ-RDKVTWPGA 296

  Fly   288 TRRINGLGLPVPKEPSRRGDLIVSFDIKFPDT-LAPSLQNQLSELL 332
            ..|....|:|..::.:::|.|:|:||::||.| |:...:.|:.|:|
 Worm   297 RLRKKDEGMPSLEDNNKKGMLVVTFDVEFPKTELSDEQKAQIIEIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 119/371 (32%)
DnaJ 4..65 CDD:278647 34/61 (56%)
DnaJ_C 157..320 CDD:199909 55/199 (28%)
dnj-20NP_001370249.1 DnaJ 23..350 CDD:223560 118/370 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.