DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnj-8

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001040753.1 Gene:dnj-8 / 174093 WormBaseID:WBGene00001026 Length:813 Species:Caenorhabditis elegans


Alignment Length:116 Identity:48/116 - (41%)
Similarity:62/116 - (53%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            :|.||:||:.|:||..|||.||:.||.::||||.|...|..||.|||||||||||..:::.:|.:
 Worm    21 EDPYKVLGISRRASAKEIKSAYKSLAREWHPDKRKDEAASGRFMEIAEAYEVLSDPLRKERYDRF 85

  Fly    68 GE-DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGG 117
            |. |.:|                 ||. |.......|:|    ||.|  ||
 Worm    86 GTFDDVK-----------------QFE-DNAERARSFYG----FGGF--GG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 48/116 (41%)
DnaJ 4..65 CDD:278647 34/60 (57%)
DnaJ_C 157..320 CDD:199909
dnj-8NP_001040753.1 DnaJ_bact 22..>86 CDD:274090 35/63 (56%)
TRX_DnaJ 118..229 CDD:239261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.