DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnj-4

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:229 Identity:59/229 - (25%)
Similarity:94/229 - (41%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGED 70
            |::||:|..|:..|||.|:...:.|.|||.:....|...|.|:..||:||.....|.::|..   
 Worm    30 YEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEESATASFLELKNAYDVLRRPADRRLYDYQ--- 91

  Fly    71 GLKGGQPGPDGGGQP-GAYTYQF-HGDPRATFAQ---FFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
             |:||     ||..| |...||: :..|:..|::   .:.|.:|        ||..|..:..:.:
 Worm    92 -LRGG-----GGRYPNGGQRYQYPNTAPQYDFSRDWSTYWSQNP--------DNSRSSREERDKS 142

  Fly   131 E-------IFW-----------NIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKK 177
            .       :.|           |.|...:.|:|      ::|.|..|:.|      |:.| |..:
 Worm   143 SREFMKSIVKWTAIGLVLVAGYNGGYLYLLAYN------QKQLDKLIDED------EIAK-CFLR 194

  Fly   178 MKISRMATGSNGPYKE-EKVLRITVKPGWKAGTK 210
            .|..|.|...:....| .::|:..|...||..|:
 Worm   195 QKEFRNANFESSEVAEIGRILKADVDEIWKTKTQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 59/229 (26%)
DnaJ 4..65 CDD:278647 21/58 (36%)
DnaJ_C 157..320 CDD:199909 14/55 (25%)
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 39/141 (28%)
DnaJ 28..89 CDD:365959 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.