DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB8

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_699161.1 Gene:DNAJB8 / 165721 HGNCID:23699 Length:232 Species:Homo sapiens


Alignment Length:128 Identity:56/128 - (43%)
Similarity:81/128 - (63%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            ::|::||::..||.::||||||||||::|||||  ...:||::||.::||||||||.|||.::|.
Human     3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDR 67

  Fly    67 YGEDGLK--GGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGG 127
            .|.|..:  ||...|........||::   :|...|.:|||..|||.  |...|:.|:..:||
Human    68 AGCDSWRAGGGASTPYHSPFDTGYTFR---NPEDIFREFFGGLDPFS--FEFWDSPFNSDRGG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 56/128 (44%)
DNAJB8NP_699161.1 PRK10767 1..>106 CDD:236757 47/105 (45%)

Return to query results.
Submit another query.