DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB8

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_699161.1 Gene:DNAJB8 / 165721 HGNCID:23699 Length:232 Species:Homo sapiens


Alignment Length:128 Identity:56/128 - (43%)
Similarity:81/128 - (63%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            ::|::||::..||.::||||||||||::|||||  ...:||::||.::||||||||.|||.::|.
Human     3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDR 67

  Fly    67 YGEDGLK--GGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGG 127
            .|.|..:  ||...|........||::   :|...|.:|||..|||.  |...|:.|:..:||
Human    68 AGCDSWRAGGGASTPYHSPFDTGYTFR---NPEDIFREFFGGLDPFS--FEFWDSPFNSDRGG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 56/128 (44%)
DnaJ 4..65 CDD:278647 35/62 (56%)
DnaJ_C 157..320 CDD:199909
DNAJB8NP_699161.1 DnaJ 3..>106 CDD:223560 47/105 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.