DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb3

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_032325.2 Gene:Dnajb3 / 15504 MGIID:1306822 Length:242 Species:Mus musculus


Alignment Length:130 Identity:63/130 - (48%)
Similarity:82/130 - (63%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            |:|::||:.|:||.:.|:|||||||||:|||||  ...:||.|||::|:|||||||.:||:::|.
Mouse     3 DYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDVRKREVYDR 67

  Fly    67 YGEDGLKGGQPGPDGGGQPGA-------YTYQFHGDPRATFAQFFGSSDPFGAFFTGGD---NMF 121
            .||.|..|      |||..|:       |.:.|. ||...|.:|||..|||...|.|||   |.|
Mouse    68 CGEVGEVG------GGGAAGSPFHDAFQYVFSFR-DPAEVFREFFGGHDPFSFDFFGGDPLENFF 125

  Fly   122  121
            Mouse   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 63/130 (48%)
DnaJ 4..65 CDD:278647 37/62 (60%)
DnaJ_C 157..320 CDD:199909
Dnajb3NP_032325.2 DnaJ 3..66 CDD:278647 37/62 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844329
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.