DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnaja1

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001158143.1 Gene:Dnaja1 / 15502 MGIID:1270129 Length:397 Species:Mus musculus


Alignment Length:397 Identity:117/397 - (29%)
Similarity:170/397 - (42%) Gaps:124/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69
            :|.:||::..|:.:|:||||||||||||||||  |...|:||:|::|||||:|.|||:::|..||
Mouse     7 YYDVLGVKPNATQEELKKAYRKLALKYHPDKN--PNEGEKFKQISQAYEVLADSKKRELYDKGGE 69

  Fly    70 DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGS-SDPFGAFFTGGDNMFSGGQGGNTNEIF 133
            ..:|.|  |..||                     ||| .|.|..||.||..|....:|.|     
Mouse    70 QAIKEG--GAGGG---------------------FGSPMDIFDMFFGGGGRMQRERRGKN----- 106

  Fly   134 WNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISR---------------- 182
                                     :.|.|.|:||::..|..:|:.:.:                
Mouse   107 -------------------------VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGA 146

  Fly   183 -------MATGSN------GP----------------------------------YKEEKVLRIT 200
                   ..||..      ||                                  .:|:|:|.:.
Mouse   147 VECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVH 211

  Fly   201 VKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVS 265
            :..|.|.|.||||..|||..|...|.||:.::..|.|::|.|.|.||.....|.|.:||||....
Mouse   212 IDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKP 276

  Fly   266 VPTLQGSRIQVNPNH--EIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDT--LAPSLQN 326
            :.||....|.:. :|  :|:|....:.:...|:|:.:.|..:|.||:.|.:.||:.  |:|...:
Mouse   277 ISTLDNRTIVIT-SHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLS 340

  Fly   327 QLSELLP 333
            .|.:|||
Mouse   341 LLEKLLP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 115/395 (29%)
DnaJ 4..65 CDD:278647 35/59 (59%)
DnaJ_C 157..320 CDD:199909 56/229 (24%)
Dnaja1NP_001158143.1 PTZ00037 2..394 CDD:240236 117/397 (29%)
CXXCXGXG motif 134..141 0/6 (0%)
CXXCXGXG motif 150..157 0/6 (0%)
CXXCXGXG motif 177..184 0/6 (0%)
CXXCXGXG motif 193..200 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.