DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajb5

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:352 Identity:178/352 - (50%)
Similarity:235/352 - (66%) Gaps:25/352 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            ||||:||||||...|::|||||||||:||||||||||...||::||||||||:||||.|||.::|
 Frog    60 MGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAEAYDVLSDPKKRAVYD 124

  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGG---QGG 127
            .|||:|||.|  |...|....::.|.|||||.||||.|||.|:||..||....:..|.|   :..
 Frog   125 QYGEEGLKTG--GGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHEDM 187

  Fly   128 NTNE----IFWNIGGDDMFAFNA----------QAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKM 178
            :.||    :|   ||...|.|:.          |..||::.||||:.|:|.|||||:..||.|:|
 Frog   188 DINEDEDDLF---GGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPPVVHELKVSLEEIYHGCTKRM 249

  Fly   179 KISRMATGSNG--PYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFK 241
            ||:|.....:|  ...|:|:|.:.:|.|||.|||||||:|||:.....||||||:::||||:|||
 Frog   250 KITRRRLNPDGRTVRTEDKILNVVIKKGWKEGTKITFPKEGDATSENIPADIVFLLKDKPHALFK 314

  Fly   242 REGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRG 306
            |:|.::.|||:|:||:||||..|::||:.| |:...|..::|||...:|:.|.|||.||.|::||
 Frog   315 RDGSNIVYTAKITLKEALCGCTVNIPTIDG-RVIPLPCSDVIKPGAVKRLRGEGLPFPKVPNQRG 378

  Fly   307 DLIVSFDIKFPDTLAPSLQNQLSELLP 333
            ||||.|.::|||.:....:..|.:.||
 Frog   379 DLIVEFQVRFPDRIPQPTRELLKQHLP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 176/350 (50%)
DnaJ 4..65 CDD:278647 44/60 (73%)
DnaJ_C 157..320 CDD:199909 86/164 (52%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 176/347 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm9327
Panther 1 1.100 - - O PTHR24078
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1020
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.