powered by:
Protein Alignment DnaJ-1 and dnajb12b
DIOPT Version :9
Sequence 1: | NP_523936.2 |
Gene: | DnaJ-1 / 38643 |
FlyBaseID: | FBgn0263106 |
Length: | 334 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001082977.1 |
Gene: | dnajb12b / 100037354 |
ZFINID: | ZDB-GENE-070410-128 |
Length: | 159 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 29/50 - (57%) |
Similarity: | 41/50 - (82%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAY 52
|::|:|||:::.||:|::||||||||||:|||||.:|.|.|.||..|..:
Zfish 108 KNYYEILGVQKDASEDDLKKAYRKLALKFHPDKNHAPGATEAFKGTASHF 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
DnaJ-1 | NP_523936.2 |
DnaJ |
1..333 |
CDD:223560 |
29/49 (59%) |
DnaJ |
4..65 |
CDD:278647 |
28/48 (58%) |
DnaJ_C |
157..320 |
CDD:199909 |
|
dnajb12b | NP_001082977.1 |
DnaJ |
109..>151 |
CDD:278647 |
25/41 (61%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170589225 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.