DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-1 and Dnajc3

DIOPT Version :9

Sequence 1:	NP_523936.2	Gene:	DnaJ-1 / 38643	FlyBaseID:	FBgn0263106	Length:	334	Species:	Drosophila melanogaster
Sequence 2:	NP_032955.2	Gene:	Dnajc3 / 100037258	MGIID:	107373	Length:	504	Species:	Mus musculus

Alignment Length:	124	Identity:	53/124 - (42%)
Similarity:	70/124 - (56%)	Gaps:	22/124 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPD----KNKSPQAEERFKEIAEAYEVLSDKKKRDI 63
            :|:|||||::|.|...||.||||||||::|||    :.:..:||::|.:||.|.|||||.:.|..
Mouse   393 RDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKK 457

  Fly    64 FDNYGEDGLKG-GQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMF 121
            ||: |||.|.. .|.|  |||.|      ||        :.:.|...|..|.:||...|
Mouse   458 FDD-GEDPLDAESQQG--GGGNP------FH--------RSWNSWQGFNPFSSGGPFRF 499

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-1	NP_523936.2	DnaJ	1..333	CDD:223560	53/124 (43%)
		DnaJ	4..65	CDD:278647	33/64 (52%)
		DnaJ_C	157..320	CDD:199909
Dnajc3	NP_032955.2	TPR_11	36..100	CDD:290150
		TPR 1	37..70
		TPR repeat	37..65	CDD:276809
		TPR repeat	70..100	CDD:276809
		TPR 2	72..104
		TPR_11	73..136	CDD:290150
		TPR 3	105..138
		TPR repeat	105..133	CDD:276809
		TPR_1	107..137	CDD:278916
		TPR_11	153..217	CDD:290150
		TPR 4	154..187
		TPR repeat	157..182	CDD:276809
		TPR_11	187..252	CDD:290150
		TPR repeat	187..217	CDD:276809
		TPR 5	188..221
		TPR 6	222..255
		TPR repeat	222..250	CDD:276809
		TPR repeat	256..280	CDD:276809
		TPR 7	268..301
		TPR repeat	301..335	CDD:276809
		TPR 8	306..339
		TPR_19	318..382	CDD:291240
		TPR 9	340..373
		TPR_1	340..373	CDD:278916
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	1/3 (33%)
		Flexible linker. /evidence=ECO:0000250	375..393		53/124 (43%)
		DnaJ	392..>498	CDD:223560	52/121 (43%)
		DnaJ	394..459	CDD:278647	33/64 (52%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	451..481		16/46 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910