DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sse and ESPL1

DIOPT Version :9

Sequence 1:NP_523935.1 Gene:Sse / 38640 FlyBaseID:FBgn0035627 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_036423.4 Gene:ESPL1 / 9700 HGNCID:16856 Length:2120 Species:Homo sapiens


Alignment Length:523 Identity:117/523 - (22%)
Similarity:204/523 - (39%) Gaps:87/523 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LTESAELENQRPTAEELIKSATKLEKKDYKSKKFLQNIIKYLQQMEQEKQP-KKPINEIPEYLDF 123
            :|||..:..:......|.:..:|.:|     .:....|...||.:..::.| ..|:..|.....|
Human  1620 VTESVSITCRHQLLTHLHRQLSKAQK-----HRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSF 1679

  Fly   124 --LDDVQDPTEGLTRISEKCNSLPQ--EWCVLQLCKSFNPATTYSVFNEIIASDGAIYLTLLRHC 184
              |:....|........|:...:|.  ..|||.|. :..|              |.:..|||...
Human  1680 RALESGHFPQPEKESFQERLALIPSGVTVCVLALA-TLQP--------------GTVGNTLLLTR 1729

  Fly   185 RSSQLGPICLKI-SNENTANLFREYSTLVERFRRVVTVDPLNMKGKE-----AKQKYWEELNGFD 243
            ......|:.::| :.:|..:|    .:::..|      |.:....||     .|:::|......|
Human  1730 LEKDSPPVSVQIPTGQNKLHL----RSVLNEF------DAIQKAQKENSSCTDKREWWTGRLALD 1784

  Fly   244 TFQQKLLADF-RDIISPYSFLFFGKRYDCTVVQKQIKATYTRVDDFCLLNQWGTHQRVLLSQAAS 307
            ...:.|:|.. :.::..:..|......:....|:.     :|:.:......|....|.||....|
Human  1785 HRMEVLIASLEKSVLGCWKGLLLPSSEEPGPAQEA-----SRLQELLQDCGWKYPDRTLLKIMLS 1844

  Fly   308 HANRLEIADLKLICYELSSNENE-----IQSAYELLKGLASDWAEVEERQPLASRRFPIILVVDE 367
            .|..|...|::.:.|.|...:.|     :..|...|:||.         .|..|.   ::||:|:
Human  1845 GAGALTPQDIQALAYGLCPTQPERAQELLNEAVGRLQGLT---------VPSNSH---LVLVLDK 1897

  Fly   368 RLDHLHWEQLVTVQEF--SRVKSLHCLWRLFQNHKSNIKHGYYTTNIKRGM------CVINPDAD 424
            .|..|.||.:.::|..  :|:.|..     |....|.||....:..:.:|:      .|:||..:
Human  1898 DLQKLPWESMPSLQALPVTRLPSFR-----FLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNN 1957

  Fly   425 LVNSGRRLRSFFEYWLSQ--WQHLFETVPNEEVMVKQALQADCFVYAGHGSGLQYVNGRIICRAR 487
            |.::..:.|:.|.   |:  |:.:...||..|.:.:...:.|.::|||||:|.::::|:.:.|..
Human  1958 LSSTEEQFRANFS---SEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLS 2019

  Fly   488 VRSVVFLFGCDSTRMLGTGLYSALYGAHDY--YHGALCPSIVGTLMPALDGNMDTVSVTILSRWL 550
            .|:|..||||.|..:...|   .|.||...  |..|.||..:|.|....|.::|..:..:|..||
Human  2020 CRAVALLFGCSSAALAVRG---NLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWL 2081

  Fly   551 APG 553
            ..|
Human  2082 GAG 2084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SseNP_523935.1 Peptidase_C50 171..538 CDD:281555 90/390 (23%)
ESPL1NP_036423.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1299..1355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1412..1485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1507..1561
Peptidase_C50 1721..2069 CDD:281555 89/385 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160153
Domainoid 1 1.000 67 1.000 Domainoid score I9900
eggNOG 1 0.900 - - E1_COG5155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7216
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003217
OrthoInspector 1 1.000 - - oto90633
orthoMCL 1 0.900 - - OOG6_103054
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R264
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.620

Return to query results.
Submit another query.