DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sse and AT5G28550

DIOPT Version :9

Sequence 1:NP_523935.1 Gene:Sse / 38640 FlyBaseID:FBgn0035627 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_198207.1 Gene:AT5G28550 / 832952 AraportID:AT5G28550 Length:286 Species:Arabidopsis thaliana


Alignment Length:304 Identity:52/304 - (17%)
Similarity:101/304 - (33%) Gaps:92/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GLTRISEKCNSLPQEWCVLQLCKSFNPATTYSVFNEIIASD---------GAIYLTLLRHCRSSQ 188
            |.|..|.....:||...:|:|..    |..::...|.:.:|         .|.::..:|..|:..
plant    39 GYTDSSTSWQGIPQADVILRLYS----AGRWTPDKECLGTDFDKTLLNVVMAAFIFSMRTLRNVD 99

  Fly   189 LGPICLKISNENTANLFREYSTLVERFRRVVTVDPLNMKGKEAKQKYWEELNGFDTFQQKLLADF 253
            :..:...::|:     ::..:.|||.......:.|..:|                    .|.|.|
plant   100 VKRLLAIVTNQ-----WKITNRLVEDVIASPWISPPELK--------------------FLFASF 139

  Fly   254 RDIISPYSFLFFGKRYDCTVVQKQIKATYTRVDDFCLLNQWGTHQRVLLSQAASHANRLEIAD-- 316
            .||    |..|:..::    ::|.     :.|...|:...| |..|:|   ...:.|:.::::  
plant   140 HDI----SVAFYNNKH----LEKA-----SMVFKLCIRTVW-TCVRLL---CQIYVNKSDLSEDC 187

  Fly   317 --------------LKLICYELSSNENEIQSAYELLKGLASDWAEVEERQPLASRRFPIILVVDE 367
                          .|...|..:.:::..:...:|...:..:|.|.|:.........||:     
plant   188 LPKEAIIDFVSEACSKSAFYLDNLHQHGARETEKLHVFILENWPEAEDLIKKLPDPTPIV----- 247

  Fly   368 RLDHLHWEQLV------TVQEFSRVKSLHCLWRLFQNHKSNIKH 405
                ..|.:||      ..|..|||..:..      ||..::.|
plant   248 ----KQWVKLVHELFLGCAQRCSRVGMISL------NHVFDVPH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SseNP_523935.1 Peptidase_C50 171..538 CDD:281555 43/266 (16%)
AT5G28550NP_198207.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.