DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sse and AT4G24300

DIOPT Version :9

Sequence 1:NP_523935.1 Gene:Sse / 38640 FlyBaseID:FBgn0035627 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_194161.1 Gene:AT4G24300 / 828533 AraportID:AT4G24300 Length:145 Species:Arabidopsis thaliana


Alignment Length:114 Identity:23/114 - (20%)
Similarity:39/114 - (34%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SIYYQVKAQFQSTDLRYLTESAELENQRPTAEELIKSATKLEKKDYKSKKFLQNIIKYLQQMEQE 107
            ||...|.......||:||...:.|:..:|.                         ::||...|..
plant     5 SIVRSVAMSRDMNDLQYLRGISLLQGLKPW-------------------------LRYLDANEHH 44

  Fly   108 KQPKKPINEIPE-YLDFLDDVQDPTEGLTRISEKCNSLPQEWCVLQLCK 155
            |..|..::::.| .|..:.:.:...|..  :...|.|..:|:.|..|.|
plant    45 KFLKLVLSDMGECALSVIREAERFDEAF--VHSFCISTLEEYSVSPLPK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SseNP_523935.1 Peptidase_C50 171..538 CDD:281555
AT4G24300NP_194161.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.