DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and cspE

DIOPT Version :10

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_415156.1 Gene:cspE / 947024 ECOCYCID:EG12179 Length:69 Species:Escherichia coli


Alignment Length:61 Identity:31/61 - (50%)
Similarity:42/61 - (68%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRV 101
            |..||||.:||:||:||.||.::||||.|.||.:||::|.|.:.||||....::|..|..|
E. coli     6 GNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANV 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 30/59 (51%)
cspENP_415156.1 cspE 1..69 CDD:169931 31/61 (51%)

Return to query results.
Submit another query.