DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and GIS2

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_014144.1 Gene:GIS2 / 855466 SGDID:S000005199 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:61 Identity:19/61 - (31%)
Similarity:28/61 - (45%) Gaps:24/61 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RCYNCGEFANHIASECALG---------------PQPKR--------CHRCRGEDHLHADC 163
            :|||||| ..|:.|||.:.               |:||:        |::|.|.:|:..||
Yeast    48 QCYNCGE-TGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDC 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905
GIS2NP_014144.1 AIR1 <1..129 CDD:227414 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.