powered by:
Protein Alignment lin-28 and GIS2
DIOPT Version :9
Sequence 1: | NP_647983.1 |
Gene: | lin-28 / 38639 |
FlyBaseID: | FBgn0035626 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014144.1 |
Gene: | GIS2 / 855466 |
SGDID: | S000005199 |
Length: | 153 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 61 |
Identity: | 19/61 - (31%) |
Similarity: | 28/61 - (45%) |
Gaps: | 24/61 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 RCYNCGEFANHIASECALG---------------PQPKR--------CHRCRGEDHLHADC 163
:|||||| ..|:.|||.:. |:||: |::|.|.:|:..||
Yeast 48 QCYNCGE-TGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDC 107
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lin-28 | NP_647983.1 |
CSP_CDS |
41..101 |
CDD:239905 |
|
GIS2 | NP_014144.1 |
AIR1 |
<1..129 |
CDD:227414 |
19/61 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.