DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and AT1G75560

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001077828.1 Gene:AT1G75560 / 843892 AraportID:AT1G75560 Length:257 Species:Arabidopsis thaliana


Alignment Length:138 Identity:34/138 - (24%)
Similarity:48/138 - (34%) Gaps:54/138 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINRRTRRMR--------CYNC-- 130
            |||...::          |.:.:.|||           |....:||.|..|        |.||  
plant    19 FRSRSPRD----------RRMRSERVS-----------YHDAPSRREREPRRAFSQGNLCNNCKR 62

  Fly   131 -GEFA---------------NHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNS---- 175
             |.||               .|||:||.   ...||..||...|:.::|.::.:..|...|    
plant    63 PGHFARDCSNVSVCNNCGLPGHIAAECT---AESRCWNCREPGHVASNCSNEGICHSCGKSGHRA 124

  Fly   176 KSISNNSS 183
            :..||:.|
plant   125 RDCSNSDS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 4/24 (17%)
AT1G75560NP_001077828.1 PTZ00368 55..172 CDD:173561 22/81 (27%)
PTZ00368 114..247 CDD:173561 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.