DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and ZCCHC9

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001124507.1 Gene:ZCCHC9 / 84240 HGNCID:25424 Length:271 Species:Homo sapiens


Alignment Length:114 Identity:25/114 - (21%)
Similarity:43/114 - (37%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FECQRTSRGL----EATRVSSRHGGSCQ--GSTYRPRINRRTRRM----------RCYNCGEFAN 135
            |.|::...|:    .|........|.|.  ||| ...|.:...::          :|:.|||. .
Human   131 FHCRKPGHGIADCPAALENQDMGTGICYRCGST-EHEITKCKAKVDPALGEFPFAKCFVCGEM-G 193

  Fly   136 HIASECALGPQ-----PKRCHRCRGEDHLHADCPHKNVTQSHSNSKSIS 179
            |::..|...|:     ...|..|...:||..|||     :|.::.:.::
Human   194 HLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCP-----ESQNSERMVT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 4/17 (24%)
ZCCHC9NP_001124507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
PTZ00368 <130..229 CDD:173561 24/104 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.