DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and GRP2

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_195580.1 Gene:GRP2 / 830024 AraportID:AT4G38680 Length:203 Species:Arabidopsis thaliana


Alignment Length:138 Identity:46/138 - (33%)
Similarity:60/138 - (43%) Gaps:33/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSR--------- 94
            |.|..|||:..||:||:||:|||.::|||||.|:..|||||..:|.||||.:..:.         
plant    11 RKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIRSEGFRSLAAEEAVEFEVEIDNNNRPKAIDVS 75

  Fly    95 GLEATRVSSRHGGSCQGST-----------------------YRPRINRRTRRMRCYNCGEFANH 136
            |.:...|....||...|..                       |..|.........||.||| ..|
plant    76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGE-PGH 139

  Fly   137 IASECALG 144
            :|.:|:.|
plant   140 MARDCSEG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 30/68 (44%)
GRP2NP_195580.1 CSD 11..77 CDD:278729 30/65 (46%)
PTZ00368 131..>201 CDD:173561 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3429
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.