DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and CSDP1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001320149.1 Gene:CSDP1 / 829758 AraportID:AT4G36020 Length:299 Species:Arabidopsis thaliana


Alignment Length:141 Identity:53/141 - (37%)
Similarity:70/141 - (49%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRG-LEATRVSSR 104
            ||..|||.:||:||:||:||..|:|||||.|...|:|||...:.|||...:.|.| .:|..|::.
plant    13 GKVNWFNASKGYGFITPDDGSVELFVHQSSIVSEGYRSLTVGDAVEFAITQGSDGKTKAVNVTAP 77

  Fly   105 HGGSCQGSTYRPRINRRTRRMR-------CYNCGEFANHIASECAL------GPQPKR----CHR 152
            .|||.:...     |.|....|       ||||||. .||:.:|.:      |.:..|    |:.
plant    78 GGGSLKKEN-----NSRGNGARRGGGGSGCYNCGEL-GHISKDCGIGGGGGGGERRSRGGEGCYN 136

  Fly   153 CRGEDHLHADC 163
            |....|...||
plant   137 CGDTGHFARDC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 30/60 (50%)
CSDP1NP_001320149.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3429
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm3561
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.