DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and PHIP1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:140 Identity:28/140 - (20%)
Similarity:37/140 - (26%) Gaps:79/140 - (56%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ATRVSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHIASECALGPQ---------------- 146
            ||.|||            .::.||.    ||.||| ..|:::.|.:..|                
plant   384 ATTVSS------------SKVKRRV----CYECGE-KGHLSTACPIKLQKADDQANSKLGQETVD 431

  Fly   147 ----------PK------------------------------------RCHRCRGEDHLHADCPH 165
                      ||                                    .|:.|..:.||...||.
plant   432 GRPAMQSYGLPKNSGDSYYMNETYASTNETYNGGYSASAVGTGKVKRRNCYECGEKGHLSTACPI 496

  Fly   166 KNVTQSHSNS 175
            |....||:||
plant   497 KLQNTSHTNS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 2/2 (100%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796
RRM1_PHIP1 163..234 CDD:240717
RRM2_PHIP1 263..334 CDD:240718
PTZ00368 393..592 CDD:173561 23/119 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.