DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and AT3G43590

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_189945.1 Gene:AT3G43590 / 823456 AraportID:AT3G43590 Length:551 Species:Arabidopsis thaliana


Alignment Length:107 Identity:27/107 - (25%)
Similarity:39/107 - (36%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 HGGSCQGSTYR----------PRINRRTRRMRCYNCGEFANHIASEC--------ALGPQPKR-C 150
            |.|...|..|.          .|:........||.||| ..|.|.||        :.|.:.:. |
plant   295 HSGLACGRHYEESNENDSATPERLFNSREASECYRCGE-EGHFARECPNSSSISTSHGRESQTLC 358

  Fly   151 HRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSE 192
            :||.|..|...:||:.:.........|.:::.|....:|.||
plant   359 YRCNGSGHFARECPNSSQVSKRDRETSTTSHKSRKKNKENSE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905
AT3G43590NP_189945.1 AIR1 130..280 CDD:227414
PTZ00368 210..374 CDD:173561 22/79 (28%)
ZnF_C2HC 327..342 CDD:197667 9/15 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.