DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and GRP2B

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_179702.1 Gene:GRP2B / 816641 AraportID:AT2G21060 Length:201 Species:Arabidopsis thaliana


Alignment Length:182 Identity:53/182 - (29%)
Similarity:71/182 - (39%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGL-EATRVS 102
            |.|..|||:..||:||:||:|||.::|||||.|:..|||||..:|.|||:.:..:.|. :|..||
plant    15 RKGTVKWFDTQKGFGFITPSDGGDDLFVHQSSIRSEGFRSLAAEESVEFDVEVDNSGRPKAIEVS 79

  Fly   103 SRHGGSCQGS--------------------------TYRPRINRRTRRMR--------CYNCGEF 133
            ...|...||:                          :|......|....|        |:.||| 
plant    80 GPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGE- 143

  Fly   134 ANHIASECAL----------------------GPQPKRCHRCRGEDHLHADC 163
            ..|:|.||:.                      |.....|:.|....|...||
plant   144 PGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGLSCYSCGESGHFARDC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 30/60 (50%)
GRP2BNP_179702.1 CSD 15..81 CDD:278729 33/65 (51%)
zf-CCHC 136..153 CDD:278525 8/17 (47%)
zf-CCHC 182..197 CDD:278525 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3429
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.