DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and CSP3

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_565427.1 Gene:CSP3 / 816297 AraportID:AT2G17870 Length:301 Species:Arabidopsis thaliana


Alignment Length:144 Identity:53/144 - (36%)
Similarity:71/144 - (49%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRG-LEATRVSS 103
            :||..||:..||:||:||:|||:|:|||||.|...|||||...|.||:|....|.| .:|..|::
plant    12 IGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSDGFRSLTLGESVEYEIALGSDGKTKAIEVTA 76

  Fly   104 RHGGSCQGSTYRPRINRRTRRMR-----CYNCGEFANHIASECALGPQPK--------------R 149
            ..|||         :|::....|     |:|||| ..|:|.:|..|...|              .
plant    77 PGGGS---------LNKKENSSRGSGGNCFNCGE-VGHMAKDCDGGSGGKSFGGGGGRRSGGEGE 131

  Fly   150 CHRCRGEDHLHADC 163
            |:.|....|...||
plant   132 CYMCGDVGHFARDC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 32/60 (53%)
CSP3NP_565427.1 CSD 13..77 CDD:278729 33/63 (52%)
PTZ00368 132..299 CDD:173561 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3429
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm3561
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.