DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and ybx1

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571695.1 Gene:ybx1 / 795398 ZFINID:ZDB-GENE-000629-3 Length:310 Species:Danio rerio


Alignment Length:138 Identity:48/138 - (34%)
Similarity:66/138 - (47%) Gaps:9/138 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 STSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG----FRSL 79
            |.||...|..|...:......||..|||||..|:||:..||..::|||||:.|:.:.    .||:
Zfish    19 SPSSPAAAATAGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSV 83

  Fly    80 GEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTY---RPRINRRTRRMRCYNCGEFANHIASEC 141
            |:.|.|||:.....:|.||..|:...|...|||.|   |.|..|..||.....  ::..:..|:.
Zfish    84 GDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNRYRRYPRRRAPPR--DYQENYQSDP 146

  Fly   142 ALGPQPKR 149
            ...|:.||
Zfish   147 EAEPREKR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 27/63 (43%)
ybx1NP_571695.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 5/11 (45%)
CSD 39..108 CDD:278729 29/68 (43%)
C5-methylcytosine binding. /evidence=ECO:0000269|PubMed:31399345, ECO:0007744|PDB:6A6J 45..50 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..310 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.