DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and csdc2b

DIOPT Version :10

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_005170841.3 Gene:csdc2b / 557375 ZFINID:ZDB-GENE-110419-1 Length:139 Species:Danio rerio


Alignment Length:75 Identity:26/75 - (34%)
Similarity:36/75 - (48%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGF 76
            :||.:.|:|..||          .|.|..|.||.|:.::|.||:.|..||.::|.|.|.|:    
Zfish    38 KRTRTYSATVRAN----------AGPVFKGVCKDFSRSQGHGFIKPAHGGDDIFFHISDIE---- 88

  Fly    77 RSLGEQEEVE 86
               ||...||
Zfish    89 ---GEYVPVE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 18/46 (39%)
csdc2bXP_005170841.3 CSP_CDS 56..120 CDD:239905 18/47 (38%)

Return to query results.
Submit another query.