DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and ybx3

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001015855.1 Gene:ybx3 / 548572 XenbaseID:XB-GENE-1007558 Length:248 Species:Xenopus tropicalis


Alignment Length:114 Identity:42/114 - (36%)
Similarity:59/114 - (51%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG---- 75
            :|.|::|......||:..:       |..|||||..|:||:..||..::|||||:.|:.:.    
 Frog    19 SSPSASSEIERKVLATKVQ-------GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKY 76

  Fly    76 FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINRRTRR 124
            .||:|:.|.|||:.....:|.||..|:...|...|||.|... .||.||
 Frog    77 LRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSRYAAD-RRRYRR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 27/63 (43%)
ybx3NP_001015855.1 CSD 36..105 CDD:278729 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.