DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and lin28a

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001016266.1 Gene:lin28a / 548523 XenbaseID:XB-GENE-491384 Length:195 Species:Xenopus tropicalis


Alignment Length:150 Identity:70/150 - (46%)
Similarity:91/150 - (60%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKCKWFNVAKGWGFL--TPNDGGQ-----EVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEA 98
            |.||||||..|:|||  |..:|..     :||||||.:.|.|||||.|.|.|||..:::|:|||:
 Frog    36 GVCKWFNVRMGFGFLTMTKKEGTDLETPVDVFVHQSKLHMEGFRSLKEGESVEFTFKKSSKGLES 100

  Fly    99 TRVSSRHGGSCQGSTYRPRI----NRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHL 159
            |||:...|..|.||..||::    .||.:..||||||...:| |.||.|.||||:||.|:..:|:
 Frog   101 TRVTGPGGAPCIGSERRPKVKGQQKRRQKGDRCYNCGGLDHH-AKECKLPPQPKKCHFCQSPNHM 164

  Fly   160 HADCPHKNVTQSHSNSKSIS 179
            .|.||.|....::...:.||
 Frog   165 VAQCPAKASQAANLEEQPIS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 35/66 (53%)
lin28aNP_001016266.1 CSP_CDS 36..105 CDD:239905 37/68 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..126 11/27 (41%)
Flexible linker. /evidence=ECO:0000250 107..130 8/22 (36%)
PTZ00368 <124..176 CDD:173561 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..195 1/9 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9390
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4499
OMA 1 1.010 - - QHG45847
OrthoDB 1 1.010 - - D1604809at2759
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 1 1.000 - - otm48970
Panther 1 1.100 - - LDO PTHR46109
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4631
SonicParanoid 1 1.000 - - X1972
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.