DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and Carhsp1

DIOPT Version :10

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_006522410.1 Gene:Carhsp1 / 52502 MGIID:1196368 Length:174 Species:Mus musculus


Alignment Length:75 Identity:28/75 - (37%)
Similarity:38/75 - (50%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGF 76
            |||.:.|:|..|:.          |.|..|.||.|..:||.||:||.|||.::|:|.|.::    
Mouse    73 RRTRTFSATVRASQ----------GPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVE---- 123

  Fly    77 RSLGEQEEVE 86
               ||...||
Mouse   124 ---GEYVPVE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 20/46 (43%)
Carhsp1XP_006522410.1 CSP_CDS 90..155 CDD:239905 20/48 (42%)

Return to query results.
Submit another query.