DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lin-28 and YBX2

DIOPT Version :9

Sequence 1:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_016880202.1 Gene:YBX2 / 51087 HGNCID:17948 Length:379 Species:Homo sapiens


Alignment Length:140 Identity:45/140 - (32%)
Similarity:61/140 - (43%) Gaps:32/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSQSSTSSANPANLASPTEE-----------CGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQ 68
            ::..|.:..|||...|.|..           .....||..|||||..|:||:..||..::|||||
Human    59 SAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQ 123

  Fly    69 ---------------SVIQMSG----FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTY 114
                           :.|:.:.    .||:|:.|.|||:.....:|.|||.|:...|...:||.|
Human   124 LENHCLVERALTGTETAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRY 188

  Fly   115 RPRINRRTRR 124
            .|  |||..|
Human   189 AP--NRRKSR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 28/78 (36%)
YBX2XP_016880202.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000228
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.